PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT32772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 411aa    MW: 43879.8 Da    PI: 7.7389
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT32772genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.71.4e-50111411128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
               +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wy Fs++dkky+tg+r+nrat++g+Wkatg+dk+++s+ ++
  EMT32772  11 VPPGFRFHPTEEELLTYYLAKKVASQRIDL-DVIRDVDLNKLEPWDIQErcRIGTgPQNDWYLFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYSAaGS 110
               69****************************.9***************953444442456**************************************9777 PP

       NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +g++ktLvfykgrap+g+k+dW+mheyrl
  EMT32772 111 GRIGMRKTLVFYKGRAPHGHKSDWIMHEYRL 141
               88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-557151IPR003441NAC domain
PROSITE profilePS5100555.04811192IPR003441NAC domain
PfamPF023652.9E-2612141IPR003441NAC domain
SuperFamilySSF1019416.02E-55180192IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MSIPVNGQSV VPPGFRFHPT EEELLTYYLA KKVASQRIDL DVIRDVDLNK LEPWDIQERC  60
RIGTGPQNDW YLFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYSAAGS GRIGMRKTLV  120
FYKGRAPHGH KSDWIMHEYR LDDAATTGKN PANPAAGNAP YYSGGSSPMG GVAGHQSSAQ  180
EDGWVICRLF KKKNIAVQHQ AGQNAGSGAA ASNNLVGAGA MARSRSNCSS TVATASDHAK  240
ATQIQQHYSA SDDGALDHIL NQYMHGRSST TSCKQETTNP SSSALDHLIN SAGHNGGSTL  300
YEKFMKLPPL EHVVPGGLLP PPTEHSGDWD ALDQLVAYEL NGLSDAPSAK TTNGMPFIVD  360
ELSGATPFSG GGTLHVSSIT GASDGDLWSL ARSVSSLHAD LRINSFNAVG C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-461119415170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3678010.0AK367801.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2062J03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701038.11e-146PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP65e-96NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM8CYJ60.0M8CYJ6_AEGTA; NAC domain-containing protein 43
STRINGMLOC_75524.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.12e-83NAC family protein